PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.61HZW
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 367aa    MW: 41268.5 Da    PI: 8.2657
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.61HZWgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.42.5e-18197251256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ +++keq  +Lee F++ ++++ ++++ LAk+l+L  rqV vWFqNrRa+ k
  Aradu.61HZW 197 RKKLRLSKEQAVVLEETFKEYNTLNPKQKQALAKQLNLRPRQVEVWFQNRRARTK 251
                  788899***********************************************98 PP

2HD-ZIP_I/II123.97.3e-40197286191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlskeq+ +LEe+F+e ++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  Aradu.61HZW 197 RKKLRLSKEQAVVLEETFKEYNTLNPKQKQALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCENLTEENRRLQKEVQELR-AL 286
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046182.2E-248160IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.603.1E-18182247IPR009057Homeodomain-like
SuperFamilySSF466891.24E-18183254IPR009057Homeodomain-like
PROSITE profilePS5007117.394193253IPR001356Homeobox domain
SMARTSM003891.0E-14195257IPR001356Homeobox domain
CDDcd000862.14E-13197254No hitNo description
PfamPF000469.7E-16197251IPR001356Homeobox domain
PROSITE patternPS000270228251IPR017970Homeobox, conserved site
PfamPF021833.3E-11253287IPR003106Leucine zipper, homeobox-associated
SMARTSM003405.7E-27253296IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MATPDEKEKM SLGLSLSLGL FGDNNNNNNN NNKNKEQEAL KLNLIQKPLP QSFPNHRLSF  60
NNLFPFHGVY LCIYLIMHFL FFFLPFYYLF IFFVLKIFNA RFFLDDLSSD TRLFLRGIDV  120
NSAPTFTAAT AATAACEDEN GVSSPNSTVS SISGKRSERE PNGNDENEAA ERASYSRGSD  180
EEDGGGIGGD ADGDSSRKKL RLSKEQAVVL EETFKEYNTL NPKQKQALAK QLNLRPRQVE  240
VWFQNRRART KLKQTEVDCE YLKRCCENLT EENRRLQKEV QELRALKLSP QLYMHMNPPT  300
TLTMCPSCER VAVSSTGSSS SSATMQSAPA SASQNQMGPN VQRPVPVNPW GAMSLQRRPI  360
ETPTTRP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1195201SRKKLRL
2245253RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016182733.10.0PREDICTED: homeobox-leucine zipper protein HAT3-like
SwissprotP466021e-98HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLA0A072TWD71e-118A0A072TWD7_MEDTR; Homeobox associated leucine zipper protein
STRINGPOPTR_0014s04460.11e-114(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF123934105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.12e-74homeobox-leucine zipper protein 3